PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10020438m
Common NameEUTSA_v10020438mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family NAC
Protein Properties Length: 554aa    MW: 62519.1 Da    PI: 4.3337
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10020438mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.11.4e-5291361128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                      l+pGfrFhPt+eelv++yLk+k+ +k++++ ++i+ +d+yk+ePwdLp k k+k+++ ewyfFs  dkky++g+++nrat++gyWk+tgkd+e+
  Thhalv10020438m   9 LAPGFRFHPTEEELVCYYLKRKICNKPFKF-DAISVTDVYKSEPWDLPdKsKLKNRDLEWYFFSVLDKKYSNGSKTNRATEKGYWKTTGKDREI 101
                      579**************************9.99**************95346777777************************************ PP

              NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       + ++++vg+kktLv++kgrap+ge+t+Wvmheyrl
  Thhalv10020438m 102 RN-GSRVVGMKKTLVYHKGRAPRGERTNWVMHEYRL 136
                      *9.9******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.24E-627159IPR003441NAC domain
PROSITE profilePS5100557.5689159IPR003441NAC domain
PfamPF023652.2E-2711136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009819Biological Processdrought recovery
GO:0010150Biological Processleaf senescence
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0005886Cellular Componentplasma membrane
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 554 aa     Download sequence    Send to blast
MSRGSETSLA PGFRFHPTEE ELVCYYLKRK ICNKPFKFDA ISVTDVYKSE PWDLPDKSKL  60
KNRDLEWYFF SVLDKKYSNG SKTNRATEKG YWKTTGKDRE IRNGSRVVGM KKTLVYHKGR  120
APRGERTNWV MHEYRLVDED LEKAGVQQGA YVLCRIFHKS GTGPKNGEQY GAPFLEEEWE  180
EEDDMTYVPD QAPASEDHVY VDVDDIVQKP HNLVVYDAVP IPLDFNLGES SDNVETNYSD  240
SVNYIQPGNC VHSNGYFERP AEFSEEEQKS IIRDGRLFSD EENGCGVKNE STENLQSSDN  300
IFETDTSHFN DFPVESNYFT GEAFLDPSSN LPQNDGLYLE TNDLSSTQQD GFDFEDYLTF  360
FDEDDENAQN LTFDPSQLMG TDDVIADQEE PLEKAETEKL EKEESSGGKQ LMGEKEMDAA  420
SCMKLVDADA TELEPDYKDP FLKKASHMLG AIPSPPAFAS EFPTKDAAIR LHAAQSSGSV  480
HVTAGLITIS DSYMGWSYRK NGNFDLIFSF GLVQENGIEK SGNSLTRAML MSMCFWFLVL  540
SVSFKVSTLV SSR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A4e-45516516174NAC domain-containing protein 19
3swm_B4e-45516516174NAC domain-containing protein 19
3swm_C4e-45516516174NAC domain-containing protein 19
3swm_D4e-45516516174NAC domain-containing protein 19
3swp_A4e-45516516174NAC domain-containing protein 19
3swp_B4e-45516516174NAC domain-containing protein 19
3swp_C4e-45516516174NAC domain-containing protein 19
3swp_D4e-45516516174NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00343DAPTransfer from AT3G10500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006407560.10.0hypothetical protein EUTSA_v10020438mg
SwissprotQ949N00.0NAC53_ARATH; NAC domain-containing protein 53
TrEMBLV4M9G80.0V4M9G8_EUTSA; Uncharacterized protein
STRINGfgenesh2_kg.3__1085__AT3G10500.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31922762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10500.10.0NAC domain containing protein 53